Product Information
98337-1-PBS targets CD93 in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2794 Product name: Recombinant Human CD93 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 24-580 aa of NM_012072.3 Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK Predict reactive species |
| Full Name | CD93 molecule |
| Calculated Molecular Weight | 69 kDa |
| GenBank Accession Number | NM_012072.3 |
| Gene Symbol | CD93 |
| Gene ID (NCBI) | 22918 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NPY3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD93, also known as C1qR or C1qR(p), is a single-pass type I transmembrane glycoprotein and a member of the group 14 of the C-type lectin-like domain (CTLD) superfamily, which also includes endosialin/CD248, thrombomodulin, and CLEC14A (PMID: 31287944). CD93 consists of a C-type lectin-like domain, five EGF-like repeats, a mucin-like domain, a transmembrane domain and a cytoplasmic domain (PMID: 28912033). CD93 is mainly expressed on endothelial cells and has been reported to be expressed by neurons and various cells of the hematopoietic system, including monocytes, neutrophils, B cells, natural killer cells, platelets and hematopoietic stem cells (PMID: 37443812). CD93 plays a role in various physiological processes including angiogenesis, inflammation, and cell adhesion (PMID: 31287944).



