CDC40 Polyclonal antibody

• 

  WB analysis using 31665-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31665-1-AP (CDC40 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

CDC40 Polyclonal Antibody for WB, ELISA

Cat No. 31665-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

PRP17, Pre mRNA processing factor 17, hPRP17, EHB3, EH binding protein 3

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HUVEC cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31665-1-AP targets CDC40 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36151

  Product name: Recombinant human CDC40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-243 aa of BC126114

  Sequence: LAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHV

• Full Name: cell division cycle 40 homolog (S. cerevisiae)
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC126114
• Gene Symbol: CDC40
• Gene ID (NCBI): 51362
• RRID: AB_3670068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O60508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDC40 (cell division cycle 40), also known as EHB3. It is expected to be located in the nucleus, which is ubiquitinated in bone marrow and lymph node. The protein is required for pre-mRNA splicing as component of the activated spliceosome, and it plays an important role in embryonic brain development; this function does not require proline isomerization (PMID: 33220177; 33220177). The molecular weight of CDC40 is 65 kDa.