CDC42 Monoclonal antibody

• 

  WB analysis using 67212-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67212-1-Ig (CDC42 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67212-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67212-1-Ig (CDC42 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 67212-1-Ig

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 67212-1-Ig (CDC42 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67212-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67212-1-Ig (CDC42 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

CDC42 Monoclonal Antibody for WB, ELISA

Cat No. 67212-1-Ig

Clone No.2G5E8

Host / Isotype

Mouse / IgM

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

2G5E8, EC:3.6.5.2, G25K, G25K GTP binding protein, G25K GTP-binding protein

---

Tested Applications

• Positive WB detected in: HeLa cells, rat brain tissue, mouse cerebellum tissue, HEK-293 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, mouse brain tissue

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67212-1-Ig targets CDC42 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28550

  Product name: Recombinant human CDC42 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-186 aa of BC002711

  Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR

• Full Name: cell division cycle 42 (GTP binding protein, 25kDa)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC002711
• Gene Symbol: CDC42
• Gene ID (NCBI): 998
• RRID: AB_2918484
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P60953
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cdc42, the human homologue of the cell division cycle 42 of Saccharomyces cerevisiae, belongs to the Rho/Rac subfamily of Ras-like GTPases. It acts as molecular switches to regulate numerous cellular responses including the organization of the actin cytoskeleton, gene transcription, cell cycle progression, and membrane trafficking