Tested Applications
| Positive WB detected in | HUVEC cells, human placenta tissue |
| Positive IHC detected in | human placenta tissue, human breast cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells |
| Positive FC detected in | HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) | FC : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27956-1-AP targets VE-cadherin/CD144 in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27487 Product name: Recombinant human CDH5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 54-241 aa of NM_001795 Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT Predict reactive species |
| Full Name | cadherin 5, type 2 (vascular endothelium) |
| Calculated Molecular Weight | 88 kDa |
| Observed Molecular Weight | 120-140 kDa |
| GenBank Accession Number | NM_001795 |
| Gene Symbol | VE-cadherin |
| Gene ID (NCBI) | 1003 |
| RRID | AB_2918136 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P33151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609). The calculated molecular weight of VE-cadherin is 88 kDa and the apparent molecular weight of 120-140 kDa is higher due to post-translational glycosylation and phosphorylation (PMID: 10460833; 29894844). Full-length VE-cadherin can be proteolytically cleaved to generate a fragment of 90-100 kDa (PMID: 9786462; 22064597).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for VE-cadherin/CD144 antibody 27956-1-AP | Download protocol |
| IF protocol for VE-cadherin/CD144 antibody 27956-1-AP | Download protocol |
| IHC protocol for VE-cadherin/CD144 antibody 27956-1-AP | Download protocol |
| WB protocol for VE-cadherin/CD144 antibody 27956-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VE-cadherin/CD144 Polyclonal antibody (Cat# 27956-1-AP) has 49 citations across journals including Circulation, Nature Communications, Advanced Materials, ACS Nano, Advanced Science, Cell Reports, Developmental Cell, Free Radical Biology and Medicine, Clinical Science, Atherosclerosis, Translational Oncology, and others. Research fields span cardiovascular disease (atherosclerosis, aortic dissection), endothelial-mesenchymal transition, diabetic vascular complications, pulmonary fibrosis, cancer, inflammation, wound healing, neurology, and stem cell-based regenerative medicine.
| Species | Application | Title |
|---|---|---|
Circulation Aberrant Phase Separation of Endothelial MAML1 Causes Congenital Heart Disease by Suppressing Notch Activity | ||
Adv Mater Engineered MSCs Break Endothelial-Myofibroblast Crosstalk in Pulmonary Fibrosis: Reconstructing the Vascular Niche | ||
Nat Commun FNIP1 abrogation promotes functional revascularization of ischemic skeletal muscle by driving macrophage recruitment | ||
ACS Nano Static Topographical Cue Combined with Dynamic Fluid Stimulation Enhances the Macrophage Extracellular Vesicle Yield and Therapeutic Potential for Bone Defects | ||
J Nanobiotechnology Synergistic dual cell therapy for atherosclerosis regression: ROS-responsive Bio-liposomes co-loaded with Geniposide and Emodin | ||
J Nanobiotechnology Platelet-rich plasma-derived extracellular vesicles delivered niraparib for ultrasound imaging and atherosclerosis treatment. |
