VE-cadherin/CD144 Monoclonal antibody

VE-cadherin/CD144 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 66804-1-Ig
Clone No.4F9B10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

VE-cadherin, 4F9B10, 7B4, 7B4 antigen, Cadherin 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue
Positive IHC detected inhuman breast cancer tissue, human tonsillitis tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue
Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:750-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66804-1-Ig targets VE-cadherin/CD144 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27501

Product name: Recombinant human CDH5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 54-241 aa of NM_001795

Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT

Predict reactive species
Full Name cadherin 5, type 2 (vascular endothelium)
Calculated Molecular Weight 88 kDa
Observed Molecular Weight125 kDa, 100 kDa
GenBank Accession NumberNM_001795
Gene Symbol VE-cadherin
Gene ID (NCBI) 1003
RRIDAB_2882147
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP33151
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609).

Protocols

Product Specific Protocols
IF protocol for VE-cadherin/CD144 antibody 66804-1-IgDownload protocol
IHC protocol for VE-cadherin/CD144 antibody 66804-1-IgDownload protocol
WB protocol for VE-cadherin/CD144 antibody 66804-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC,IF

Adv Mater

Glycated ECM Derived Carbon Dots Inhibit Tumor Vasculogenic Mimicry by Disrupting RAGE Nuclear Translocation and Its Interaction With HMGB1

Authors - Shaoting Zheng
humanWB

Acta Pharmacol Sin

Endothelial deubiquinatase YOD1 mediates Ang II-induced vascular endothelial-mesenchymal transition and remodeling by regulating β-catenin

Authors - Wan-Te Lin
WB

EMBO Rep

Mouse endothelial OTUD1 promotes angiotensin II-induced vascular remodeling by deubiquitinating SMAD3

Authors - Zhuqi Huang

Biomed Pharmacother

Ginsenoside Rg1 ameliorates hypoxia-induced pulmonary arterial hypertension by inhibiting endothelial-to-mesenchymal transition and inflammation by regulating CCN1

Authors - Bai-Lin Tang
humanIF

Regen Biomater

Microvascular network based on the Hilbert curve for nutrient transport in thick tissue

Authors - Zhenxing Wang
humanIF

J Invest Dermatol

Endothelial Piezo1 mediates barrier dysfunction and NLRP3 inflammasomes activation in psoriasis

Authors - Lixin Yue
Loading...
||
New chat Able
正在加载,请稍候...