Product Information
83635-3-PBS targets CDK2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species |
Full Name | cyclin-dependent kinase 2 |
Calculated Molecular Weight | 298 aa, 34 kDa |
GenBank Accession Number | BC003065 |
Gene Symbol | CDK2 |
Gene ID (NCBI) | 1017 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P24941 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |