CDK2 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83635-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83635-3-PBS against Human CDK2 was performed. The affinity constant is below 1 pM.

CDK2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83635-3-PBS

Clone No.240580B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CDKN2, Cell division protein kinase 2, Cyclin dependent kinase 2, Cyclin-dependent kinase 2, EC:2.7.11.22

---

Product Information

83635-3-PBS targets CDK2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17133

  Product name: Recombinant human CDK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 217-298 aa of BC003065

  Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL

• Full Name: cyclin-dependent kinase 2
• Calculated Molecular Weight: 298 aa, 34 kDa
• GenBank Accession Number: BC003065
• Gene Symbol: CDK2
• Gene ID (NCBI): 1017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.