p35 Polyclonal antibody

• 

  WB analysis using 18346-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18346-1-AP (p35 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 18346-1-AP

  IP result of anti-p35 (IP:18346-1-AP, 4ug; Detection:18346-1-AP 1:500) with mouse brain tissue lysate 3440ug.

p35 Polyclonal Antibody for WB, IP, ELISA

Cat No. 18346-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CDK5R1, CDK5 activator 1, CDK5P35, CDK5R, Cyclin-dependent kinase 5 activator 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

18346-1-AP targets p35 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13152

  Product name: Recombinant human CDK5R1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 99-307 aa of BC020580

  Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

• Full Name: cyclin-dependent kinase 5, regulatory subunit 1 (p35)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC020580
• Gene Symbol: CDK5R1
• Gene ID (NCBI): 8851
• RRID: AB_2878535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15078
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form (PMID: 10830966).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Neurobiol; Extracellular CIRP Induces Calpain Activation in Neurons via PLC-IP3-Dependent Calcium Pathway; Authors - Archna Sharma
mouse	WB	Neuropharmacology; Inhibition of Cdk5 rejuvenates inhibitory circuits and restores experience-dependent plasticity in adult visual cortex.; Authors - Yue Li
mouse	WB	Front Aging Neurosci; The γ-Adducin 1-357 fragment promotes tau pathology; Authors - Honglu Yu