Tested Applications
Positive WB detected in | Jurkat cells, C2C12 cells, MOLT-4 cells, NIH/3T3 cells, K-562 cells |
Positive IP detected in | Jurkat cells |
Positive IHC detected in | human urothelial carcinoma tissue, human endometrial cancer tissue, human lung cancer tissue, mouse colon tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 208 publications below |
IHC | See 20 publications below |
IF | See 3 publications below |
IP | See 2 publications below |
CoIP | See 2 publications below |
Product Information
14052-1-AP targets CDK6 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, zebrafish, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5275 Product name: Recombinant human CDK6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC027989 Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Predict reactive species |
Full Name | cyclin-dependent kinase 6 |
Calculated Molecular Weight | 326 aa, 36 kDa |
Observed Molecular Weight | 36-40 kDa |
GenBank Accession Number | BC027989 |
Gene Symbol | CDK6 |
Gene ID (NCBI) | 1021 |
RRID | AB_10642144 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q00534 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin-dependent kinase 6 (CDK6) is an enzyme belonging to the CDK family. CDK6 is a catalytic subunit of a
protein kinase complex that is essential for progression through the G1 phase of the cell cycle and G1/S transition,
thus activating cell proliferation. CDK6 partners with cyclins to phosphorylate the retinoblastoma (pRb) protein to
release its binding partner E2F; a transcription factor that drives gene expression necessary for DNA replication
(PMID: 8114739). CDK6 was long thought of as a redundant homolog of CDK4 as they perform similar roles in cell
cycle progression. But recently it has become apparent that CDK6 and CDK4 differ in tissue-specific functions,
where CDK6 plays a role in differentiation (PMID: 16410727) but also in contribution to tumor development.
What is the molecular weight of CDK6?
The molecular weight of CDK6 is approximately 36-40 kDa (PMID: 23563707, 8114739).
What is the subcellular localization of CDK6?
CDK6 is ubiquitously expressed through the nucleus and cytoplasm. However, the most active complexes are
located in the nuclei of proliferating cells.
What is the expression pattern of CDK6?
CDK6 activity first occurs midway through the G1 phase. Its expression is regulated by D-type cyclins and
members of the INK4 family of CDK inhibitors (PMID: 7739547).
What is CDK6's role in cancer?
CDK6 is involved in a critical regulatory point in the cell cycle and so is found to be unbalanced in approximately
80-90% of tumors (PMID: 23356980). Loss of cell cycle control is the initial step in the development of the
hallmarks of cancer, such as sustained proliferative signaling and dysregulated cellular energetics. Deregulation
of CDK6 has an important role in lymphoma by increasing angiogenesis (PMID: 23948297) and upregulated CDK6
expression is also associated with a poor clinical prognosis in medulloblastoma (PMID: 23172372).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDK6 antibody 14052-1-AP | Download protocol |
IHC protocol for CDK6 antibody 14052-1-AP | Download protocol |
IF protocol for CDK6 antibody 14052-1-AP | Download protocol |
IP protocol for CDK6 antibody 14052-1-AP | Download protocol |
FC protocol for CDK6 antibody 14052-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun The RNA-binding protein LRPPRC promotes resistance to CDK4/6 inhibition in lung cancer | ||
Genome Biol Single-cell transcriptomics reveals multiple chemoresistant properties in leukemic stem and progenitor cells in pediatric AML | ||
Nat Commun ICAM1 initiates CTC cluster formation and trans-endothelial migration in lung metastasis of breast cancer. | ||
Nat Commun Identification of predictors of drug sensitivity using patient-derived models of esophageal squamous cell carcinoma. | ||
Dev Cell DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice |