Use Able AI chat for product recommendations

CDR2 Polyclonal antibody

CDR2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11611-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

CDR2, CDR62, PCD17, Yo

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue, Y79 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11611-2-AP targets CDR2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2183

Product name: Recombinant human CDR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 105-454 aa of BC017503

Sequence: SKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

Predict reactive species
Full Name cerebellar degeneration-related protein 2, 62kDa
Calculated Molecular Weight 454 aa, 52 kDa
Observed Molecular Weight 62 kDa
GenBank Accession NumberBC017503
Gene Symbol CDR2
Gene ID (NCBI) 1039
RRIDAB_2076734
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01850
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Patients with paraneoplastic cerebellar degeneration (PCD) carry a characteristic antibody called anti-Yo. On Western blot analysis of Purkinje cells and tumor tissue from CD patient, the anti-Yo sera react with at least 2 antigens, a major species of 62 kD called CDR62 or CDR2 [PMID:18045792]. CDR2 is partly characterized, as CDR2 through its leucine zipper motif has been demonstrated to interact with c-myc, with cell cycle-related proteins and with a protein kinase, indicating that CDR2 is involved in signal transduction and gene transcription. Furthermore, CDR2 has been found to attenuate hypoxic response in renal cell carcinoma, and recent data suggest a role for CDR2 and c-myc in mitosis in cycling cells [PMID:21080165].

Protocols

Product Specific Protocols
IHC protocol for CDR2 antibody 11611-2-APDownload protocol
WB protocol for CDR2 antibody 11611-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIP, WB

Acta Neuropathol

Paraneoplastic CDR2 and CDR2L antibodies affect Purkinje cell calcium homeostasis.

Authors - Manja Schubert

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


anwesh (Verified Customer) (11-11-2019)

CDR2 was successfully IP'ed from A549 cells. The antibody had not background bands.

  • Applications: Immunoprecipitation,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: A594 cells

anwesh (Verified Customer) (07-29-2019)

The protein was found at the right size and no additional background bands were observed around the size range. Perfect!

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 293T, U2OS, HaCaT
CDR2 Antibody Western Blot, validation (1:1000 dilution) in 293T, U2OS, HaCaT (Cat no:11611-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...