CEA/CD66e Polyclonal antibody

• 

  WB analysis using 10421-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10421-1-AP (CEA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 10421-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10421-1-AP (CEA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10421-1-AP (CEA antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10421-1-AP (CEA antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 10421-1-AP (CEA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human stomach cancer using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 10421-1-AP (CEA antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung cancer using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10421-1-AP (CEA antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human lung cancer using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10421-1-AP (CEA antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human appendicitis using 10421-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 10421-1-AP (CEA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human colon cancer using 10421-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CEA antibody (10421-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human colon cancer using 10421-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CEA antibody (10421-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CEA/CD66e Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 10421-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, chIP, ELISA

Synonyms

CEA, Meconium antigen 100, CEACAM5, CD66e, Carcinoembryonic antigen-related cell adhesion molecule 5

---

Tested Applications

• Positive WB detected in: HT-29 cells, MCF-7 cells, human saliva
• Positive IHC detected in: human colon cancer tissue, human appendicitis tissue, human stomach cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human colon cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 4 publications below
• ChIP: See 1 publications below

Product Information

10421-1-AP targets CEA/CD66e in WB, IHC, IF-P, chIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0672

  Product name: Recombinant human CEACAM5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC034671

  Sequence: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 5
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 180-200 kDa, 77 kDa
• GenBank Accession Number: BC034671
• Gene Symbol: CEA
• Gene ID (NCBI): 1048
• RRID: AB_2244691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Transl Res; Molecular signature of interleukin-22 in colon carcinoma cells and organoid models.; Authors - Ina Rudloff
human	WB	J Cell Mol Med; CD39 Contributes to the Ability of Cell Invasion in Heterogeneity of Colorectal Cancer; Authors - Xiaosong Li
human	WB,IHC,chIP	Int J Biol Sci; FBW7 suppresses metastasis of colorectal cancer by inhibiting HIF1α/CEACAM5 functional axis.; Authors - Qingguo Li ; KD Validated
human	IHC	Gene Ther; Lentivirus-mediated RASSF1A expression suppresses aggressive phenotypes of gastric cancer cells in vitro and in vivo.; Authors - P-H Zhou
human	IHC	World Neurosurg; Discovery of Aquaporin-1 and Aquaporin-4 Expression in an Intramedullary Spinal Cord Ependymal Cyst: Case Report.; Authors - Matthew J Shepard
human	WB	PLoS One; Correlation of alpha-1 antitrypsin levels and exosome associated neutrophil elastase endothelial injury in subjects with SARS-CoV2 infection; Authors - Jorge Lascano

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Claire (Verified Customer) (09-30-2024)

A repeat order of an antibody previously used in colorectal adenocarcinoma research as this produced excellent images previously, we are now aiming to optimise this antibody for pancreatic work

• Applications: Immunohistochemistry, Immunofluorescence
• Cell Tissue Type: Colorectal adenocarcinoma / pancreatic carcinoma