FcZero-rAb® Biotin Anti-Human CEACAM8/CD66b Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using Biotin-FcA98507-2

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Biotin Anti-Human CEACAM8/CD66b Rabbit RecAb (Biotin-FcA98507-2, Clone: 242954D11) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using Biotin-FcA98507-2

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Biotin Anti-Human CEACAM8/CD66b Rabbit RecAb (Biotin-FcA98507-2, Clone: 242954D11) (red) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CEACAM8/CD66b FcZero-rAb^® Recombinant Antibody for FC

Cat No. Biotin-FcA98507-2

Clone No.242954D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD66b, CEACAM8, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CD 66b

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98507-2 targets CEACAM8/CD66b in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32133

  Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 35-319 aa of BC026263

  Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 8
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: BC026263
• Gene Symbol: CEACAM8
• Gene ID (NCBI): 1088
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31997
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392).