Use Able AI chat for product recommendations

CEND1 Polyclonal antibody

CEND1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

BM88 antigen, BM88

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CEND1 in ?

Tested Applications

Positive WB detected inmouse brain tissue, SH-SY5Y cells, human brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13280-1-AP targets CEND1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityrat, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4024

Product name: Recombinant human CEND1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-123 aa of BC034732

Sequence: MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFN

Predict reactive species
Full Name cell cycle exit and neuronal differentiation 1
Calculated Molecular Weight 149 aa, 15 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC034732
Gene Symbol CEND1
Gene ID (NCBI) 51286
RRIDAB_2291632
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N111
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cell cycle exit and neuronal differentiation 1 (CEND1) also known as BM88, is a neuronal protein associated in vivo with terminal neuron-generating divisions, marking the exit of proliferative cells from the cell cycle (PMID: 17971443). CEND1 expression is critical for the NEUROG2-driven reprogramming of astrocytes, suggesting the existence of a reciprocal feedback loop leading to neurogenesis (PMID: 26321141). CEND1 is an integral membrane protein composed of two 23-kDa polypeptide chains linked together by disulfide bridges.

Protocols

Product Specific Protocols
IF protocol for CEND1 antibody 13280-1-APDownload protocol
IHC protocol for CEND1 antibody 13280-1-APDownload protocol
WB protocol for CEND1 antibody 13280-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CEND1 Polyclonal antibody (Cat# 13280-1-AP) has 2 total citations. These appear in Cell Death Discovery (IF 10.4), covering miR-204-5p regulation of adipose-derived stem cell differentiation into three germ layers, and Journal of Ethnopharmacology (IF 6.8), addressing protective mechanisms of essential oil in allergic rhinitis via NF-κB and T-bet/GATA-3 signaling pathways. Both citations used WB application, with species being goat and rat respectively. The research fields span stem cell biology and immunology/inflammation.

SpeciesApplicationTitle
goatWB

Cell Death Discov

Molecular mechanism underlying miR-204-5p regulation of adipose-derived stem cells differentiation into cells from three germ layers

Authors - Zhimin Wang
ratWB

J Ethnopharmacol

The Protective Effects and Mechanisms of Essential oil from Chimonanthus nitens Oliv. Leaves in Allergic Rhinitis Based on the NF-κB and T-bet/GATA-3 signaling pathways

Authors - Xiaoying Huang
Loading...
||
New chat

Able™

正在加载,请稍候...