CEP135 Polyclonal antibody

CEP135 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 24428-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, Canine and More (1)

Applications

WB, IF/ICC, ELISA

centrosomal protein 135kDa, Centrosomal protein 4, Centrosomal protein of 135 kDa, CEP135, CEP4, KIAA0635

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, K-562 cells, U2OS cells, U-87 MG cells
Positive IF/ICC detected inMDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24428-1-AP targets CEP135 in WB, IF/ICC, ELISA applications and shows reactivity with human, Canine samples.

Tested Reactivity human, Canine
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19122

Product name: Recombinant human CEP135 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-233 aa of BC136535

Sequence: MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQ

Predict reactive species
Full Name centrosomal protein 135kDa
Calculated Molecular Weight 1140 aa, 134 kDa
Observed Molecular Weight 135 kDa
GenBank Accession NumberBC136535
Gene Symbol CEP135
Gene ID (NCBI) 9662
RRIDAB_2879543
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ66GS9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEP135 is a 135 kDa centrosomal protein that is present in a wide range of organisms. CEP135 is located at the centrosome throughout the cell cycle, and localization is independent of the microtubule network. It distributes throughout the centrosomal area in association with the electron-dense material surrounding centrioles.

Protocols

Product Specific Protocols
IF protocol for CEP135 antibody 24428-1-APDownload protocol
WB protocol for CEP135 antibody 24428-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Curr Biol

SAS-6 Association with γ-Tubulin Ring Complex Is Required for Centriole Duplication in Human Cells.

Authors - Hindol Gupta
WB

Cell Rep

DPCD is a regulator of R2TP in ciliogenesis initiation through Akt signaling

Authors - Yu-Qian Mao
mouseIF

EMBO Rep

ENKD1 promotes CP110 removal through competing with CEP97 to initiate ciliogenesis.

Authors - Ting Song
human

Elife

WDR90 is a centriolar microtubule wall protein important for centriole architecture integrity.

Authors - Emmanuelle Steib
humanIF

Cells

Mitotic Maturation Compensates for Premature Centrosome Splitting and PCM Loss in Human cep135 Knockout Cells.

Authors - Zhenzhen Chu
humanIF

J Cell Sci

Separation-of-function MCPH-associated mutations in CPAP affect centriole number and length

Authors - Sonal Jaiswal

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Elisa (Verified Customer) (01-25-2023)

RPE1 cells stained for Hoechst (DNA marker, in blue), Cep135 (in magenta) and g-Tubulin (pericentriolar matrix marker, in green). RPE1 cells were fixed in cold methanol for 10' at -20C. Cells were then rehydrated with PBS for 5'. Membrane permeabilization was then performed with 0.1% Triton + 0.1% Tween +0.01%SDS in PBS for 5'. Cells were finally incubated with blocking buffer (5% BSA+ 0.1% Tween in PBS) for 30' at RT. Primary antibody was diluted in blocking buffer 1:200 and incubated for 1h at room temperature. Alexa-488-Anti-rabbit was used as secondary antibody (1:600 dilution) (1h at room temperature).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Human retinal pigment epithelial-1 (RPE-1)
CEP135 Antibody Immunofluorescence validation (1:200 dilution) in Human retinal pigment epithelial-1 (RPE-1) (Cat no:24428-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...