CoraLite® Plus 488-conjugated CEP135 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-24428

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 CEP135 antibody (CL488-24428) at dilution of 1:200.

CEP135 Polyclonal Antibody for IF/ICC

Cat No. CL488-24428

Host / Isotype

Rabbit / IgG

Reactivity

human, Canine

Applications

IF/ICC

Synonyms

centrosomal protein 135kDa, Centrosomal protein 4, Centrosomal protein of 135 kDa, CEP135, CEP4, KIAA0635

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24428 targets CEP135 in IF/ICC applications and shows reactivity with human, Canine samples.

• Tested Reactivity: human, Canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19122

  Product name: Recombinant human CEP135 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-233 aa of BC136535

  Sequence: MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEPYKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQQEVHQLQEKLAMMESGVRDYSKQ

• Full Name: centrosomal protein 135kDa
• Calculated Molecular Weight: 1140 aa, 134 kDa
• Observed Molecular Weight: 133 kDa
• GenBank Accession Number: BC136535
• Gene Symbol: CEP135
• Gene ID (NCBI): 9662
• RRID: AB_3084080
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q66GS9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CEP135 is a 135 kDa centrosomal protein that is present in a wide range of organisms. CEP135 is located at the centrosome throughout the cell cycle, and localization is independent of the microtubule network. It distributes throughout the centrosomal area in association with the electron-dense material surrounding centrioles.