CEP170 Polyclonal antibody

• 

  WB analysis of MCF-7 using 27325-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27325-1-AP (CEP170 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 27325-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27325-1-AP (CEP170 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 27325-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 27325-1-AP (CEP170 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CEP170 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27325-1-AP

Publications(8)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

centrosomal protein 170kDa, Centrosomal protein of 170 kDa, CEP170, FAM68A, KAB, KARP 1 binding protein, KARP1 binding protein, KIAA0470

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IF: See 6 publications below

Product Information

27325-1-AP targets CEP170 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26311

  Product name: Recombinant human CEP170 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1012-1202 aa of BC140794

  Sequence: EASDSELADADKASVASEVSTTSSTSKPPTGRRNISRIDLLAQPRRTRLGSLSARSDSEATISRSSASSRTAEAIIRSGARLVPSDKFSPRIRANSISRLSDSKVKSMTSAHGSASVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTSPALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHRE

• Full Name: centrosomal protein 170kDa
• Calculated Molecular Weight: 1486 aa, 165 kDa
• Observed Molecular Weight: 170-190 kDa
• GenBank Accession Number: BC140794
• Gene Symbol: CEP170
• Gene ID (NCBI): 9859
• RRID: AB_2880844
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5SW79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Science; A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes.; Authors - Chun So
	WB	Nat Commun; CEP128 is involved in spermatogenesis in humans and mice.; Authors - Xueguang Zhang
human	IF	J Cell Biol; DNA damage promotes microtubule dynamics through a DNA-PK-AKT axis for enhanced repair.; Authors - Shuyun Ma
human	WB,IF	Elife; α-/γ-Taxilin are required for centriolar subdistal appendage assembly and microtubule organization.; Authors - Dandan Ma ; KD Validated
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu
human	WB,IF	Reprod Biomed Online; A novel CCDC39 mutation causes multiple morphological abnormalities of the flagella in a primary ciliary dyskinesia patient; Authors - Daijuan Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ilham (Verified Customer) (08-06-2024)

CEP170 works very well I confirm that the observed molecular weight is higher than the calculated molecular weight, using at 1:1000 in 5% milk TBSt O/N (LI-COR).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000

FH

Laura (Verified Customer) (02-27-2019)

Comparing with antibodies from other companies that we bought, this antibody is the best that we tried for IF and Western Blot !

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: if 1/200
• Cell Tissue Type: Rpe1