Product Information
66928-3-PBS targets CFTR as part of a matched antibody pair:
MP50929-1: 66928-2-PBS capture and 66928-3-PBS detection (validated in Cytometric bead array)
MP50929-2: 66928-4-PBS capture and 66928-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27810 Product name: Recombinant human CFTR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-80 aa of NM_000492 Sequence: MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWR Predict reactive species |
Full Name | cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) |
Calculated Molecular Weight | 168 kDa |
GenBank Accession Number | NM_000492 |
Gene Symbol | CFTR |
Gene ID (NCBI) | 1080 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P13569 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |