CHCHD5 Polyclonal antibody, PBS Only

• 

  WB analysis using 25711-1-AP (same clone as 25711-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25711-1-AP (CHCHD5 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25711-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 25711-1-AP (same clone as 25711-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 25711-1-AP (CHCHD5 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25711-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 25711-1-AP (same clone as 25711-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CHCHD5 antibody (25711-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 25711-1-PBS in a different storage buffer formulation.

CHCHD5 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25711-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25711-1-PBS targets CHCHD5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22503

  Product name: Recombinant human CHCHD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC004498

  Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 5
• Calculated Molecular Weight: 110 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC004498
• Gene Symbol: CHCHD5
• Gene ID (NCBI): 84269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSY4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.