Product Information
25711-1-PBS targets CHCHD5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22503 Product name: Recombinant human CHCHD5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC004498 Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 5 |
| Calculated Molecular Weight | 110 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC004498 |
| Gene Symbol | CHCHD5 |
| Gene ID (NCBI) | 84269 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BSY4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





