CHD9 Polyclonal antibody, PBS Only

• 

  WB analysis using 13402-1-AP (same clone as 13402-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 13402-1-AP (CHD9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13402-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 13402-1-AP (same clone as 13402-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 13402-1-AP (CHD9 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13402-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13402-1-AP (same clone as 13402-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 13402-1-AP (CHD9 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13402-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13402-1-AP (same clone as 13402-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 13402-1-AP (CHD9 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13402-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Hela using 13402-1-AP (same clone as 13402-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Hela cells using CHD9 antibody (13402-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 13402-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHD9 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13402-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

AD013, AD-013, ATP-dependent helicase CHD9, CHD-9, Chromatin-related mesenchymal modulator

---

Product Information

13402-1-PBS targets CHD9 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4245

  Product name: Recombinant human CHD9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC033770

  Sequence: MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQGTPTHQKMTDFEQLNQFDSIKFHHVNQSFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSDGSPMWGHQTATTISNQNGSPFHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSAVLASNHTNQTLSDFTGSNSFSPHRGIKQESTQHILNPNTSLNSNNFQILHSSHPQGNYS

• Full Name: chromodomain helicase DNA binding protein 9
• Calculated Molecular Weight: 2897 aa, 326 kDa
• Observed Molecular Weight: 330 kDa
• GenBank Accession Number: BC033770
• Gene Symbol: CHD9
• Gene ID (NCBI): 80205
• RRID: AB_10640425
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3L8U1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHD (chromodomain helicase DNA-binding) proteins are chromatin remodelling enzymes which reshape the local chromatin architecture to allow access to transcriptional machinery in a tissue-specific context. CHD proteins facilitate various stages of gene expression, including binding and recruiting transcription factors, histone modifications, and transcriptional elongation, termination and processing. CHD proteins are characterized by two tandem chromodomains and a helicase C domain, but also possesses additional functional domains which classify them into three subfamilies. CHD9 is active in mesenchymal stromal stem cells and osteoprogenitor cells, and is suggested to control osteogenic cell fate (PMID: 32295522).