Chromogranin A Polyclonal antibody

Chromogranin A Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 10529-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

CGA, CHGA, AL-11, Chromogranin-A, EA-92

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-12 cells, mouse adrenal gland tissue, SH-SY5Y cells, rat adrenal gland tissue
Positive IHC detected inhuman lung cancer tissue, human colon tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue, mouse small intestine tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10529-1-AP targets Chromogranin A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0807

Product name: Recombinant human CHGA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-457 aa of BC006459

Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Predict reactive species
Full Name chromogranin A (parathyroid secretory protein 1)
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 70-85 kDa
GenBank Accession NumberBC006459
Gene Symbol Chromogranin A
Gene ID (NCBI) 1113
RRIDAB_2081122
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10645
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.

Protocols

Product Specific Protocols
IF protocol for Chromogranin A antibody 10529-1-APDownload protocol
IHC protocol for Chromogranin A antibody 10529-1-APDownload protocol
WB protocol for Chromogranin A antibody 10529-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell Metab

Glycerate from intestinal fructose metabolism induces islet cell damage and glucose intolerance.

Authors - Yanru Wu
mouseWB,IF

Phytomedicine

Study on the effects of the atractylodes macrocephala koidz-raphanus sativus l herb pair in alleviating senile constipation via the gut microbiota-SCFAs-5-HT axis

Authors - Fan Gao
humanWB

Cell Biosci

Profile of chimeric RNAs and TMPRSS2-ERG e2e4 isoform in neuroendocrine prostate cancer

Authors - Qiong Wang
humanWB

Sci Rep

Generation and characterization of CRISPR/Cas9-mediated MEN1 knockout BON1 cells: a human pancreatic neuroendocrine cell line.

Authors - Azita Monazzam
humanWB

Discov Oncol

Depiction of neuroendocrine features associated with immunotherapy response using a novel one-class predictor in lung adenocarcinoma

Authors - Hao Liu
mouseIHC

Dose Response

The Protective Effects of Apigenin Against Radiation-Induced Intestinal Injury.

Authors - Danjie Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Adam (Verified Customer) (09-25-2025)

Slight background but still sharp bands with no off target bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:600
  • Cell Tissue Type: CWR22Rvq
FH

Madeline (Verified Customer) (09-25-2025)

This antibody works very well- I have repurchased several times within the last year. Clear expression in western blot application with good bands.

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: PC cell line
FH

balawant (Verified Customer) (07-26-2022)

This Antibody is working great. I have used for colon and colon cancer cell line

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Susmita (Verified Customer) (04-13-2022)

This antibody works excellent.

  • Applications: Western Blot
  • Primary Antibody Dilution: WB: 1: 1500
  • Cell Tissue Type: PC cell line
FH

James (Verified Customer) (03-31-2021)

Antibody worked well in both recombinant Chromogranin A produced in both HeLa cell lysates and in HEK cells overexpressed with Chromogranin A

  • Applications: Western Blot, Cell culture
  • Cell Tissue Type: HeLa cell lysate IVT expression and HEK cell overexpression
FH

Iram (Verified Customer) (08-14-2020)

Used 1:1000 dilution for immunoblotting. It gives a very clean band.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000 for western and 1:100 for IHC
  • Cell Tissue Type: Human colon cancer
Loading...
||
New chat Able
正在加载,请稍候...