CHM Polyclonal antibody

• 

  WB analysis using 26251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26251-1-AP (CHM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse placenta using 26251-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 26251-1-AP (CHM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 26251-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CHM antibody (26251-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

CHM Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26251-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Choroideraemia protein, REP1, REP 1, Rab escort protein 1, GGTA

---

Tested Applications

• Positive WB detected in: A431 cells, Caco-2 cells, HEK-293T cells, HeLa cells
• Positive IHC detected in: mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26251-1-AP targets CHM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23166

  Product name: Recombinant human CHM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-110 aa of BC063522

  Sequence: VSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYGRSTLLL

• Full Name: choroideremia (Rab escort protein 1)
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC063522
• Gene Symbol: CHM
• Gene ID (NCBI): 1121
• RRID: AB_3669530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24386
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHM (Choroideremia protein) is also named as Rab escort protein 1 (REP-1), TCD and Rab proteins geranylgeranyltransferase component A 1. Choroideremia (CHM) is an X-linked recessive eye disease that is caused by null mutations in REP-1, a gene involved in the regulation of Rab GTPases and intracellular vesicular transport (PMID: 9067750, PMID: 16936131). REP-1 is involved in trafficking of Rab proteins in the cell. And REP-1 binds newly synthesized Rab proteins and presents them to the catalytic site of RabGGTase (PMID: 19427510). RAB-27 in several neurons, such as motor neurons at neuromuscular junctions, requires REP-1 for normal synaptic transmission responsible for aldicarb sensitivity (PMID: 19090809). REP-1 acts as a component of the protein complex. There are two similar Rab escort proteins (75% sequence identity): REP-1 and REP-2. A 95-kDa protein (previously designated component A and now called REP-1) is present (PMID: 8294464, PMID: 17140818).