CHML Polyclonal antibody

• 

  WB analysis using 31663-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31663-1-AP (CHML antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

CHML Polyclonal Antibody for WB, ELISA

Cat No. 31663-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

REP2

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293T cells, NCI-H1299 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31663-1-AP targets CHML in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35925

  Product name: Recombinant human CHML protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-215 aa of NM_001821.3

  Sequence: KEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRN

• Full Name: choroideremia-like (Rab escort protein 2)
• Calculated Molecular Weight: 74kDa，656aa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: NM_001821.3
• Gene Symbol: CHML
• Gene ID (NCBI): 1122
• RRID: AB_3670066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P26374
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.