CHML Polyclonal antibody

CHML Polyclonal Antibody for WB, ELISA
Cat No. 31663-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

REP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293T cells, NCI-H1299 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31663-1-AP targets CHML in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag35925

Product name: Recombinant human CHML protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-215 aa of NM_001821.3

Sequence: KEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRN

Predict reactive species
Full Name choroideremia-like (Rab escort protein 2)
Calculated Molecular Weight74kDa,656aa
Observed Molecular Weight90-100 kDa
GenBank Accession NumberNM_001821.3
Gene Symbol CHML
Gene ID (NCBI) 1122
RRIDAB_3670066
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP26374
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for CHML antibody 31663-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...