CHML Polyclonal antibody, PBS Only

• 

  WB analysis using 31663-1-AP (same clone as 31663-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31663-1-AP (CHML antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31663-1-PBS in a different storage buffer formulation.

CHML Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31663-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31663-1-PBS targets CHML in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35925

  Product name: Recombinant human CHML protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-215 aa of NM_001821.3

  Sequence: KEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRN

• Full Name: choroideremia-like (Rab escort protein 2)
• Calculated Molecular Weight: 74kDa，656aa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: NM_001821.3
• Gene Symbol: CHML
• Gene ID (NCBI): 1122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P26374
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.