CHMP4C Polyclonal antibody, PBS Only

• 

  WB analysis using 16256-1-AP (same clone as 16256-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16256-1-AP (CHMP4C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16256-1-PBS in a different storage buffer formulation.

CHMP4C Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16256-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

chromatin modifying protein 4C, Chromatin-modifying protein 4c, hSnf7 3, hSnf7-3, hVps32 3

---

Product Information

16256-1-PBS targets CHMP4C in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9279

  Product name: Recombinant human CHMP4C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC014321

  Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT

• Full Name: chromatin modifying protein 4C
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 35 -42 kDa
• GenBank Accession Number: BC014321
• Gene Symbol: CHMP4C
• Gene ID (NCBI): 92421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CF2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHMP4C (Charged multivesicular body protein 4c), also known as SHAX3. It is expected to be located in the cytoplasm and membrane, which is expressed in heart, spleen and kidney. CHMP4C is one of the charged multivesicular protein (CHMP), and is involved in the composition of the endosomal sorting complex required for transport III (ESCRT-III), facilitating the necessary separation of daughter cells. CHMP4C has been proposed to be involved in the progression of different carcinomas. The molecular weight of CHMP4C is 26 kDa. Phosphorylated at Ser-210 by AURKB during cytokinesis: together with ZFYVE19/ANCHR, phosphorylated CHMP4C retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Phosphorylation and ubiquitination modification may lead to molecular weight of 35-42kd.