CHST4 Monoclonal antibody, PBS Only

• 

  WB analysis of HT-29 using 66623-1-Ig (same clone as 66623-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66623-1-Ig (CHST4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  WB analysis of T-47D using 66623-1-Ig (same clone as 66623-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 66623-1-Ig (CHST4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66623-1-Ig (same clone as 66623-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66623-1-Ig (CHST4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 66623-1-Ig (same clone as 66623-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66623-1-Ig (CHST4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66623-1-Ig (same clone as 66623-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66623-1-Ig (CHST4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66623-1-Ig (same clone as 66623-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66623-1-Ig (CHST4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66623-1-Ig (same clone as 66623-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CHST4 antibody (66623-1-Ig, Clone: 1E1A4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66623-1-Ig (same clone as 66623-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66623-1-Ig (CHST4 antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66623-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHST4 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66623-1-PBS

Clone No.1E1A4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Gn6st-2, Gn6st 2, GlcNAc6ST-2, GlcNAc6ST 2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3

---

Product Information

66623-1-PBS targets CHST4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3987

  Product name: Recombinant human CHST4 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 177-386 aa of BC035282

  Sequence: DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH

• Full Name: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
• Calculated Molecular Weight: 370 aa, 43 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC035282
• Gene Symbol: CHST4
• Gene ID (NCBI): 10164
• RRID: AB_2881983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NCG5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHST4, also named as HEC GlcNAc6ST and GlcNAc6ST 2, is one of a major GlcNAc-6-O-sulfotransferases involved in synthesizing the L-selectin ligands mediating lymphocyte homing. CHST4 is associated with the expression of MECA-79 epitope on HEV. It has been reported that the transcripts of CHST4 can be detected in lymph node, liver, pancreas and high endothelial venules (HEVs) but at a low level in HUVECs. Besides, CHST4 is expressed at a high level in gastric and colorectal cancer patients compared with normal mucosa. (PMID:30093410, 27748735, 10330415)