CISD3 Polyclonal antibody

• 

  WB analysis using 30480-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30480-1-AP (CISD3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 30480-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30480-1-AP (CISD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 30480-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30480-1-AP (CISD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CISD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30480-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CDGSH iron sulfur domain 3, Miner2, MitoNEET related protein 2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat liver tissue, mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

30480-1-AP targets CISD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32754

  Product name: Recombinant human CISD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-127 aa of NM_001136498.1

  Sequence: ARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL

• Full Name: CDGSH iron sulfur domain 3
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_001136498.1
• Gene Symbol: CISD3
• Gene ID (NCBI): 284106
• RRID: AB_3086332
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0C7P0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; CISD3 is a prognostic biomarker and therapeutic target in pan-cancer; Authors - Jie Li ; KD Validated