• Featured Product
  • KD/KO Validated

Cytokeratin 7 Monoclonal antibody

Cytokeratin 7 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 66483-1-Ig
Clone No.2E1G5

Host / Isotype

Mouse / IgG2a

Reactivity

Human and More (2)

Applications

WB, IHC, IF-P, ELISA

Cell and organelle markers, CK 7, CK7, Cytokeratin 7, Cytoskeleton Marker, K2C7, K7, keratin 7, KRT7, Sarcolectin, SCL, Type II keratin Kb7

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A431 cells, T-47D cells, PC-3 cells, HeLa cells, HepG2 cells, BxPC-3 cells
Positive IHC detected inhuman lung cancer tissue, human ovary tumor tissue, human kidney tissue, human pancreas tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman prostate cancer tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:10000-1:40000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66483-1-Ig targets Cytokeratin 7 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7895

Product name: Recombinant human CK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC002700

Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR

Predict reactive species
Full Name keratin 7
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC002700
Gene Symbol Cytokeratin 7
Gene ID (NCBI) 3855
RRIDAB_2881849
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08729
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7, also named as cytokeratin 7, is one member of type II basic cytokeratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels, and their neoplasms. KRT7 is marker of epithelial tissues, but not present in carcinomas of stratified squamous cell origin.This antibody is specifically against KRT7.

Protocols

Product Specific Protocols
WB protocol for Cytokeratin 7 antibody 66483-1-IgDownload protocol
IHC protocol for Cytokeratin 7 antibody 66483-1-IgDownload protocol
IF protocol for Cytokeratin 7 antibody 66483-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC,IF

Oxid Med Cell Longev

Deletion of ACLY Disrupts Histone Acetylation and IL-10 Secretion in Trophoblasts, Which Inhibits M2 Polarization of Macrophages: A Possible Role in Recurrent Spontaneous Abortion.

Authors - Xin Chen
humanIHC

Front Oncol

Significance of mouse xenograft tumor model using patient-derived cancer organoids for clinical drug development

Authors - Hisataka Ogawa
humanWB

Sci Rep

Long-term expansion of basal cells and the novel differentiation methods identify mechanisms for switching Claudin expression in normal epithelia

Authors - Akihito Inoko
humanIF

Life Sci

Cyclophilin A inhibits trophoblast migration and invasion in vitro and vivo through p38/ERK/JNK pathways and causes features of preeclampsia in mice.

Authors - Haoyue Hu
humanIHC

Placenta

MiR-187 regulates the proliferation, migration and invasion of human trophoblast cells by repressing BCL6-mediated activation of PI3K/AKT signaling.

Authors - Xin Chen
humanIF

Gene

Comprehensive analysis of placental gene-expression profiles and identification of EGFR-mediated autophagy and ferroptosis suppression in intrahepatic cholestasis of pregnancy.

Authors - Yan Fang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Santhosh (Verified Customer) (04-15-2019)

Human breast tumor FFPE tissue. HIER using citrate buffer. 1:200

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:200
Cytokeratin 7 Antibody Immunohistochemistry, validation (1:200 dilution) in (Cat no:66483-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...