• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated Cytokeratin 7 Monoclonal antibody

Cytokeratin 7 Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL555-66483
Clone No.2E1G5

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF-P, FC (Intra)

KRT7, 2E1G5, CK 7, CK7, CK-7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman prostate cancer tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-66483 targets Cytokeratin 7 in IF-P, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7895

Product name: Recombinant human CK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC002700

Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR

Predict reactive species
Full Name keratin 7
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC002700
Gene Symbol Cytokeratin 7
Gene ID (NCBI) 3855
RRIDAB_2923897
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08729
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7, also named as cytokeratin 7, is one member of type II basic cytokeratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels, and their neoplasms. KRT7 is marker of epithelial tissues, but not present in carcinomas of stratified squamous cell origin.This antibody is specifically against KRT7.

Protocols

Product Specific Protocols
FC protocol for CL555 Cytokeratin 7 antibody CL555-66483Download protocol
IF protocol for CL555 Cytokeratin 7 antibody CL555-66483Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...