• Featured Product
  • KD/KO Validated

Cytokeratin 7 Monoclonal antibody, PBS Only

Cytokeratin 7 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 66483-1-PBS
Clone No.2E1G5

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF-P, Indirect ELISA

Cell and organelle markers, CK 7, CK7, Cytokeratin 7, Cytoskeleton Marker, K2C7, K7, keratin 7, KRT7, Sarcolectin, SCL, Type II keratin Kb7

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66483-1-PBS targets Cytokeratin 7 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7895

Product name: Recombinant human CK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC002700

Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR

Predict reactive species
Full Name keratin 7
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC002700
Gene Symbol Cytokeratin 7
Gene ID (NCBI) 3855
RRIDAB_2881849
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08729
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT7, also named as cytokeratin 7, is one member of type II basic cytokeratin. It is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels, and their neoplasms. KRT7 is marker of epithelial tissues, but not present in carcinomas of stratified squamous cell origin.This antibody is specifically against KRT7.

Loading...
||
New chat Able
正在加载,请稍候...