CKB/CKM Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66764-1-Ig (same clone as 66764-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66764-1-Ig (CKB/CKM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66764-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66764-1-Ig (same clone as 66764-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66764-1-Ig (CKB/CKM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66764-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66764-1-Ig (same clone as 66764-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66764-1-Ig (CKB/CKM antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66764-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66764-1-Ig (same clone as 66764-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66764-1-Ig (CKB/CKM antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66764-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CKB/CKM Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66764-1-PBS

Clone No.2B7C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

CKB, KCRB, 2B7C3, B CK, B-CK

---

Product Information

66764-1-PBS targets CKB/CKM in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7933

  Product name: Recombinant human CKB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-381 aa of BC001190

  Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

• Full Name: creatine kinase, brain
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC001190
• Gene Symbol: CKB
• Gene ID (NCBI): 1152
• RRID: AB_2882110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12277
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CKBB, also named as B-CK and CKB, is a member of the ATP:guanido phosphotransferase protein family. It is a cytoplasmic enzyme involved in energy homeostasis. CKBB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. CK isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. CK MB consists of a dimer of nonidentical chains. With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain. This antibody can recognize both CKB and CKM due to the high homology.