CLCA1 Polyclonal antibody, PBS Only

CLCA1 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 25291-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Calcium-activated chloride channel regulator 1, Calcium-activated chloride channel protein 1, Calcium-activated chloride channel family member 1, CaCC-1, CACC1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

25291-1-PBS targets CLCA1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18176

Product name: Recombinant human CLCA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 715-914 aa of BC156805

Sequence: EINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDLFIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILKIMWKWIGELQLSIA

Predict reactive species
Full Name chloride channel accessory 1
Calculated Molecular Weight 914 aa, 100 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC156805
Gene Symbol CLCA1
Gene ID (NCBI) 1179
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA8K7I4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Calcium-activated chloride channel regulator 1(CLCA1) is a secreted protein, and it has an N-terminal zinc-dependent metallohydrolase domain with a conserved HExxE catalytic motif similar to that found in matrix metalloproteases (MMPs), and "a Disintegrin and metalloproteases" (ADAMs). The only known substrate for CLCA1 is CLCA1 itself as it undergoes intracellular autocatalytic cleavage resulting in two cleavage products which are both secreted. Since a previous study suggested that a band around 75 kDa, corresponding to the N-terminal autocatalytic cleavage product, was observed in mucus from both human and WT mice. In addition, an additional band at 50 kDa was identified in human and WT mouse mucus, suggesting that CLCA1 can be further processed. However, no band corresponding to the full-length un-cleaved CLCA1 could be detected in the human samples, and only a very faint band was observed in WT mouse mucus, indicating that most of the CLCA1 that is secreted into the mucus is fully cleaved in vivo. (PMID: 29885864)

Loading...
||
New chat Able
正在加载,请稍候...