CLEC3B Recombinant monoclonal antibody, PBS Only

• 

CLEC3B Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85689-2-PBS

Clone No.243017E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

C-type lectin domain family 3 member B, Plasminogen kringle 4-binding protein, Tetranectin, TN, TNA

---

Product Information

85689-2-PBS targets CLEC3B in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3063

  Product name: Recombinant Human CLEC3B protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-202 aa of NM_003278.2

  Sequence: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

• Full Name: C-type lectin domain family 3, member B
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: NM_003278.2
• Gene Symbol: CLEC3B
• Gene ID (NCBI): 7123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05452
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.