CLEC4D Polyclonal antibody, PBS Only

• 

  WB analysis of human peripheral blood leukocyte using 18930-1-AP (same clone as 18930-1-PBS)

  Human peripheral blood leukocyte cells were subjected to SDS PAGE followed by western blot with 18930-1-AP (CLEC4D antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18930-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 18930-1-AP (same clone as 18930-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18930-1-AP (CLEC4D Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18930-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 18930-1-AP (same clone as 18930-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18930-1-AP (CLEC4D Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18930-1-PBS in a different storage buffer formulation.

CLEC4D Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18930-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18930-1-PBS targets CLEC4D in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6852

  Product name: Recombinant human CLEC4D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 40-215 aa of BC032313

  Sequence: LVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

• Full Name: C-type lectin domain family 4, member D
• Calculated Molecular Weight: 215 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC032313
• Gene Symbol: CLEC4D
• Gene ID (NCBI): 338339
• RRID: AB_2878568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXI8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.