Product Information
30680-1-PBS targets CLOCK in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33370 Product name: Recombinant human CLOCK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC041878 Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDW Predict reactive species |
| Full Name | clock homolog (mouse) |
| Calculated Molecular Weight | 846 aa, 95 kDa |
| GenBank Accession Number | BC041878 |
| Gene Symbol | CLOCK |
| Gene ID (NCBI) | 9575 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15516 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. (PMID: 30683868).





