CLRN1 Polyclonal antibody

• 

  WB analysis of HeLa using 26630-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 26630-1-AP (CLRN1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 26630-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26630-1-AP (CLRN1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 26630-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26630-1-AP (CLRN1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26630-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26630-1-AP (CLRN1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 26630-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26630-1-AP (CLRN1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CLRN1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26630-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

clarin 1, CLRN1, USH3, USH3A, Usher syndrome type 3 protein

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: mouse testis tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26630-1-AP targets CLRN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24289

  Product name: Recombinant human CLRN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 156-232 aa of BC074970

  Sequence: ASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY

• Full Name: clarin 1
• Calculated Molecular Weight: 232 aa, 26 kDa
• Observed Molecular Weight: 23 kDa, 27 kDa
• GenBank Accession Number: BC074970
• Gene Symbol: CLRN1
• Gene ID (NCBI): 7401
• RRID: AB_2880579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P58418
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	J Pathol; Clarin-1 expression in adult mouse and human retina highlights a role of Müller glia in Usher syndrome.; Authors - Lei Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sunny (Verified Customer) (10-02-2025)

The antibody helped capture the full length Clarin-1 protein which was produced in our lab using the cell free expression system of ALiCE. This was a good confirmation of the produced protein after we saw the SDS- PAGE band.

• Applications: Western Blot
• Primary Antibody Dilution: 1:6000