Tested Applications
| Positive WB detected in | mouse brain tissue, pig brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13302-1-AP targets CLSTN3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4107 Product name: Recombinant human CLSTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-289 aa of BC039075 Sequence: VLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPMEVRGLGKRGSVGSRLWSTHVLPESAVLCDGGCWGPAGG Predict reactive species |
| Full Name | calsyntenin 3 |
| Calculated Molecular Weight | 968 aa, 107 kDa |
| Observed Molecular Weight | 110-130 kDa |
| GenBank Accession Number | BC039075 |
| Gene Symbol | CLSTN3 |
| Gene ID (NCBI) | 9746 |
| RRID | AB_2877936 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BQT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calsyntenins, also called alcadeins, are cadherin superfamily proteins first identified as synaptic proteins (PMID: 11161476; 12498782). Calsyntenins are type I transmembrane proteins with extracellular domains containing two cadherin repeats and an LNS (laminin, neurexin, sex hormone-binding globulin) domain (PMID: 24613359). Calsyntenin-3 (CLSTN3, also known as alcadein-beta) is a synapse-organizing protein that promotes the development of synapses. It is a postsynaptic adhesion molecule that binds to presynaptic neurexins to mediate both excitatory and inhibitory synapse formation (PMID: 25352602; 24613359).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CLSTN3 antibody 13302-1-AP | Download protocol |
| WB protocol for CLSTN3 antibody 13302-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CLSTN3 Polyclonal antibody (Cat# 13302-1-AP) has 7 citations published in Nature, International Journal of Biological Macromolecules, NPJ Parkinson's Disease, Molecular Metabolism, International Journal of Molecular Sciences, Neuroscience, and Animals (Basel). Research fields span lipid metabolism and adipose tissue biology, vitamin C transport, Parkinson's disease and neurotransmission, obesity, hepatic encephalopathy and Alzheimer's disease, neuronal injury in intracerebral hemorrhage, and lipid droplet regulation.
| Species | Application | Title |
|---|---|---|
Int J Biol Macromol Calsyntenin-3 interacts with the sodium-dependent vitamin C transporter-2 to regulate vitamin C uptake | ||
NPJ Parkinsons Dis Disruption of the LRRK2 substrate RAB12 facilitates neurotransmission and causes hyperactivity in mice. | ||
Mol Metab CLSTN3 gene variant associates with obesity risk and contributes to dysfunction in white adipose tissue. | ||
Int J Mol Sci Transcriptome Profile in the Mouse Brain of Hepatic Encephalopathy and Alzheimer’s Disease | ||
Neuroscience CircAFF2 promotes neuronal cell injury in intracerebral hemorrhage by regulating the miR-488/calsyntenin-3 axis
|
