CLSTN3 Polyclonal antibody

• 

  WB analysis using 13302-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13302-1-AP (CLSTN3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 13302-1-AP

  pig brain tissue were subjected to SDS PAGE followed by western blot with 13302-1-AP (CLSTN3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 13302-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13302-1-AP (CLSTN3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13302-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13302-1-AP (CLSTN3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CLSTN3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13302-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat, pig and More (1)

Applications

WB, IHC, IP, CoIP, ELISA, IF

Synonyms

calsyntenin 3, Alc-beta, alcbeta, Alcadein-beta, Alcadein beta

---

Tested Applications

• Positive WB detected in: mouse brain tissue, pig brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

13302-1-AP targets CLSTN3 in WB, IHC, IP, CoIP, ELISA, IF applications and shows reactivity with mouse, rat, pig samples.

• Tested Reactivity: mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4107

  Product name: Recombinant human CLSTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 206-289 aa of BC039075

  Sequence: VLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPMEVRGLGKRGSVGSRLWSTHVLPESAVLCDGGCWGPAGG

• Full Name: calsyntenin 3
• Calculated Molecular Weight: 968 aa, 107 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC039075
• Gene Symbol: CLSTN3
• Gene ID (NCBI): 9746
• RRID: AB_2877936
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQT9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calsyntenins, also called alcadeins, are cadherin superfamily proteins first identified as synaptic proteins (PMID: 11161476; 12498782). Calsyntenins are type I transmembrane proteins with extracellular domains containing two cadherin repeats and an LNS (laminin, neurexin, sex hormone-binding globulin) domain (PMID: 24613359). Calsyntenin-3 (CLSTN3, also known as alcadein-beta) is a synapse-organizing protein that promotes the development of synapses. It is a postsynaptic adhesion molecule that binds to presynaptic neurexins to mediate both excitatory and inhibitory synapse formation (PMID: 25352602; 24613359).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Nature; CLSTN3β enforces adipocyte multilocularity to facilitate lipid utilization; Authors - Kevin Qian
human,mouse	WB,IF	Mol Metab; CLSTN3 gene variant associates with obesity risk and contributes to dysfunction in white adipose tissue.; Authors - Ningning Bai
human	WB,CoIP	Int J Biol Macromol; Calsyntenin-3 interacts with the sodium-dependent vitamin C transporter-2 to regulate vitamin C uptake; Authors - Veedamali S. Subramanian
mouse	WB	Neuroscience; CircAFF2 promotes neuronal cell injury in intracerebral hemorrhage by regulating the miR-488/calsyntenin-3 axis; Authors - Juxing Qi ; KD Validated
mouse	WB	Int J Mol Sci; Transcriptome Profile in the Mouse Brain of Hepatic Encephalopathy and Alzheimer’s Disease; Authors - Young-Kook Kim