Tested Applications
Positive WB detected in | HEK-293 cells |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21657-1-AP targets CNGA3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16385 Product name: Recombinant human CNGA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 590-694 aa of BC096298 Sequence: EYPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ Predict reactive species |
Full Name | cyclic nucleotide gated channel alpha 3 |
Calculated Molecular Weight | 694 aa, 79 kDa |
Observed Molecular Weight | 98 kDa |
GenBank Accession Number | BC096298 |
Gene Symbol | CNGA3 |
Gene ID (NCBI) | 1261 |
RRID | AB_10734591 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16281 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CNGA3 is a member of the cyclic nucleotide-gated cation channel protein family which is required for normal vision and olfactory signal transduction. Mutations in CNGA3 gene are associated with achromatopsia (rod monochromacy) and color blindness. Three alternatively spliced transcripts encoding different isoforms have been described. This antibody detects CNGA3 with an apparent molecular weight of 98 kDa which has been reported (PMID: 20378608).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CNGA3 antibody 21657-1-AP | Download protocol |
IHC protocol for CNGA3 antibody 21657-1-AP | Download protocol |
IP protocol for CNGA3 antibody 21657-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |