CNTN2 Polyclonal antibody

• 

CNTN2 Polyclonal Antibody for ELISA

Cat No. 27122-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

Axonal glycoprotein TAG 1, Axonin 1, AXT, CNTN2, Contactin 2, contactin 2 (axonal), TAG 1, TAG1, TAX, TAX 1, TAX1

---

Product Information

27122-1-AP targets CNTN2 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25898

  Product name: Recombinant human CNTN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 865-943 aa of NM_005076

  Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA

• Full Name: contactin 2 (axonal)
• Calculated Molecular Weight: 113 kDa
• GenBank Accession Number: NM_005076
• Gene Symbol: CNTN2
• Gene ID (NCBI): 6900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.