CNTROB Monoclonal antibody

• 

  WB analysis using 67061-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67061-1-Ig (CNTROB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 67061-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67061-1-Ig (CNTROB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 67061-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67061-1-Ig (CNTROB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of hTERT-RPE1 using 67061-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CNTROB antibody (67061-1-Ig, Clone: 3D12A4 ) at dilution of 1:350 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), ARL13B antibody (17711-1-AP, red).

CNTROB Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67061-1-Ig

Clone No.3D12A4

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, ELISA

Synonyms

3D12A4, Centrobin, Centrosomal BRCA2-interacting protein, LIP8, LYST interacting protein 8

---

Tested Applications

• Positive WB detected in: A549 cells, pig brain tissue, rat brain tissue, NCI-H1299 cells, JAR cells, Jurkat cells, K-562 cells
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:175-1:700

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

67061-1-Ig targets CNTROB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25447

  Product name: Recombinant human CNTROB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC021134

  Sequence: MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTRVLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTRLEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET

• Full Name: centrobin, centrosomal BRCA2 interacting protein
• Calculated Molecular Weight: 903 aa, 101 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC021134
• Gene Symbol: CNTROB
• Gene ID (NCBI): 116840
• RRID: AB_2882371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8N137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Mol Biol Cell; Binding of CEP152 to PLK4 stimulates kinase activity to promote centriole assembly; Authors - Hazal Kübra Gürkaşlar