CNTROB Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67061-1-Ig (same clone as 67061-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67061-1-Ig (CNTROB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67061-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67061-1-Ig (same clone as 67061-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67061-1-Ig (CNTROB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67061-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67061-1-Ig (same clone as 67061-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67061-1-Ig (CNTROB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67061-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 using 67061-1-Ig (same clone as 67061-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CNTROB antibody (67061-1-Ig, Clone: 3D12A4 ) at dilution of 1:350 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), ARL13B antibody (17711-1-AP, red). This data was developed using the same antibody clone with 67061-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50605-2

  Cytometric bead array standard curve of MP50605-2, CNTROB Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67061-4-PBS. Detection antibody: 67061-1-PBS. Standard:Ag25447. Range: 1.563-100 ng/mL.

CNTROB Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67061-1-PBS

Clone No.3D12A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

3D12A4, Centrobin, Centrosomal BRCA2-interacting protein, LIP8, LYST interacting protein 8

---

Product Information

67061-1-PBS targets CNTROB as part of a matched antibody pair:

MP50605-2: 67061-4-PBS capture and 67061-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25447

  Product name: Recombinant human CNTROB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC021134

  Sequence: MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTRVLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTRLEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET

• Full Name: centrobin, centrosomal BRCA2 interacting protein
• Calculated Molecular Weight: 903 aa, 101 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC021134
• Gene Symbol: CNTROB
• Gene ID (NCBI): 116840
• RRID: AB_2882371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8N137
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.