Tested Applications
| Positive WB detected in | BxPC-3 cells, HeLa cells, SKOV-3 cells, C2C12 cells |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30045-1-AP targets Collagen Type XII in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32602 Product name: Recombinant human COL12A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 768-892 aa of NM_004370 Sequence: VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG Predict reactive species |
| Full Name | collagen, type XII, alpha 1 |
| Calculated Molecular Weight | 333kd |
| Observed Molecular Weight | 310-333 kDa |
| GenBank Accession Number | NM_004370 |
| Gene Symbol | COL12A1 |
| Gene ID (NCBI) | 1303 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99715 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COL12A1 (Collagen alpha-1(XII) chain), also known as COL12A1L. It is predicted to be located in the ECM. Type XII collagen interacts with type I collagen-containing fibrils, the COL1 domain could be associated with the surface of the fibrils, and the COL2 and NC3 domains may be localized in the perifibrillar matrix. The molecular weight of COL12A1 is 333 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Collagen Type XII antibody 30045-1-AP | Download protocol |
| WB protocol for Collagen Type XII antibody 30045-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



