Collagen Type XV Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83031-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 83031-4-PBS against Human Collagen Type XV was performed. The affinity constant is 1.38 nM.

Collagen Type XV Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83031-4-PBS

Clone No.230248G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

COL15, COL15A1, Collagen alpha 1(XV) chain, Collagen alpha-1(XV) chain, Collagen XV alpha 1

---

Product Information

83031-4-PBS targets Collagen Type XV in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34644

  Product name: Recombinant human COL15A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-358 aa of BC157094

  Sequence: EEHSRIPFQRSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEGTLETTNMSIIQHSSPKQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLA

• Full Name: collagen, type XV, alpha 1
• GenBank Accession Number: BC157094
• Gene Symbol: COL15A1
• Gene ID (NCBI): 1306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P39059
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.