Collagen Type I Polyclonal antibody

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig skin using 14695-1-AP

  pig skin tissue were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  human placenta tissue was subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of U-87 MG using 14695-1-AP

  IP result of anti-Collagen Type I (IP:14695-1-AP, 4ug; Detection:14695-1-AP 1:2000) with U-87 MG cells lysate 1920 ug.

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of SW480 using 14695-1-AP

  1X10^6 SW480 cells were intracellularly stained with 0.2 ug Anti-Human Collagen Type I (14695-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

The Collagen Type I polyclonal antibody (14695-1-AP) is one of the most highly cited Collagen Type I antibodies in the market. It is suitable for WB, IHC, FC (Intra), IP, ELISA and has been referenced in over 1,221 publications.

Cat No. 14695-1-AP

Publications(1221)

Reviews (9)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (8)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

Synonyms

COL1, COL1A2, Alpha-2 type I collagen, col I, Collagen alpha 2(I) chain

---

Tested Applications

• Positive WB detected in: U-87 MG cells, human placenta tissue, MG-63 cells, pig skin tissue, Saos-2 cells
• Positive IP detected in: U-87 MG cells
• Positive IHC detected in: human colon tissue, human breast cancer tissue, human oesophagus cancer tissue, human placenta tissue, human skin cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: SW480 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 965 publications below
• IHC: See 260 publications below
• IF: See 227 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

14695-1-AP targets Collagen Type I in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, bovine, toad, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6281

  Product name: Recombinant human COL1A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1017-1366 aa of BC054498

  Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

• Full Name: collagen, type I, alpha 2
• Calculated Molecular Weight: 1366 aa, 130 kDa
• Observed Molecular Weight: 130-160 kDa，210-250kDa
• GenBank Accession Number: BC054498
• Gene Symbol: COL1A2
• Gene ID (NCBI): 1278
• RRID: AB_2082037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08123
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cancer Cell; Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis; Authors - Jiang Chang
rabbit	IF	Adv Mater; A Superparamagnetic Composite Hydrogel Scaffold as in Vivo Dynamic Monitorable Theranostic Platform for Osteoarthritis Regeneration; Authors - Mayifei Rong
mouse	WB	Gastroenterology; Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells; Authors - Decai Wang
rat	IF	Adv Mater; Acid-Induced in Situ Phase Separation and Percolation for Constructing Bi-Continuous Phase Hydrogel Electrodes With Motion-Insensitive Property; Authors - Qingquan Han
mouse	WB	Gut; Histone methyltransferase Suv39h1 regulates hepatic stellate cell activation and is targetable in liver fibrosis; Authors - Ming Kong
rat	IHC	Bioact Mater; Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair; Authors - Changjian Lin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

p (Verified Customer) (09-23-2024)

Excellent

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: HEK

Collagen Type I Antibody Western Blot validation (1000 dilution) in HEK (Cat no:14695-1-AP)

FH

Brice-Emmanuel (Verified Customer) (10-12-2023)

I have 2 bands in 70 kDa

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Mouse Heart Tissue

Collagen Type I Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:14695-1-AP)

FH

S (Verified Customer) (03-20-2023)

Excellent Antibody!

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: fibroblast

Collagen Type I Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:14695-1-AP)

FH

Balawant Kumar (Verified Customer) (12-20-2022)

antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: colon tissue and colon cancer cell line (caco2, HCT116)

FH

PK (Verified Customer) (07-08-2022)

Very Good

• Applications: Western Blot
• Cell Tissue Type: Fibroblast

Collagen Type I Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:14695-1-AP)

FH

Ren Jie (Verified Customer) (06-22-2022)

Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot

• Applications: Western Blot, Other
• Primary Antibody Dilution: 1:1000

FH

S (Verified Customer) (12-01-2021)

Excellent

• Applications: Western Blot
• Cell Tissue Type: LUNG FIBROBLASTS

Collagen Type I Antibody Western Blot validation ( dilution) in LUNG FIBROBLASTS (Cat no:14695-1-AP)

FH

Hala (Verified Customer) (02-23-2021)

very good

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000

FH

Eistine (Verified Customer) (05-31-2019)

The antibody works pretty good

• Applications: Immunofluorescence,