Collagen Type I Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Collagen Type I Polyclonal antibody (14695-1-AP)

The Collagen Type I polyclonal antibody (14695-1-AP) is one of the most highly cited Collagen Type I antibodies in the market. It is suitable for WB, IHC, IF-P, IP, ELISA and has been referenced in over 1,685 publications.

Cat No. 14695-1-AP Copied!

Publications (1685)

Reviews (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (7)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA, Western Blot

Synonyms

COL1, COL1A2, Alpha-2 type I collagen, col I, Collagen alpha 2(I) chain

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig skin using 14695-1-AP

  pig skin tissue were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14695-1-AP

  human placenta tissue was subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of U-87 MG using 14695-1-AP

  IP result of anti-Collagen Type I (IP:14695-1-AP, 4ug; Detection:14695-1-AP 1:2000) with U-87 MG cells lysate 1920 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human colon cancer using 14695-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human colon cancer tissue using Collagen Type I antibody (14695-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Collagen Type I in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-87 MG cells, human placenta tissue, MG-63 cells, pig skin tissue, Saos-2 cells
• Positive IP detected in: U-87 MG cells
• Positive IHC detected in: human colon tissue, human breast cancer tissue, human oesophagus cancer tissue, human placenta tissue, human skin cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human colon cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14695-1-AP targets Collagen Type I in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA, Western Blot applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, mouse, rat, pig, rabbit, chicken, hamster, sheep, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6281

  Product name: Recombinant human COL1A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1017-1366 aa of BC054498

  Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

• Full Name: collagen, type I, alpha 2
• Calculated Molecular Weight: 1366 aa, 130 kDa
• Observed Molecular Weight: 130-160 kDa
• GenBank Accession Number: BC054498
• Gene Symbol: COL1A2
• Gene ID (NCBI): 1278
• RRID: AB_2082037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08123
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Publications

What published studies show

The Collagen Type I Polyclonal antibody (Cat# 14695-1-AP) has 1,685 total citations. These appear in high-impact journals including Nature, Cancer Cell, Gastroenterology, Advanced Materials, Nature Communications, Bioactive Materials, Biomaterials, Theranostics, Autophagy, Redox Biology, Journal of Nanobiotechnology, Cell Death & Disease, and Acta Pharmaceutica Sinica B. Research fields span fibrosis (liver, pulmonary, cardiac, renal, skin), bone and cartilage regeneration, wound healing, tissue engineering, nanomedicine, and cancer biology, with applications mainly in WB, IF, and IHC.

Automatically generated from the 1,685 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Signal Transduct Target Ther; Overexpression of STX11 alleviates pulmonary fibrosis by inhibiting fibroblast activation via the PI3K/AKT/mTOR pathway; Authors - Guichuan Huang
rat,mouse	WB,IF	Signal Transduct Target Ther; 2-APQC, a small-molecule activator of Sirtuin-3 (SIRT3), alleviates myocardial hypertrophy and fibrosis by regulating mitochondrial homeostasis; Authors - Fu Peng
mouse	IF	Nature; Cartilage-like protein hydrogels engineered via entanglement; Authors - Linglan Fu
human	IF	Cancer Cell; Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis; Authors - Jiang Chang
mouse	WB	Gastroenterology; Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells; Authors - Decai Wang
		Adv Mater; Engineered MSCs Break Endothelial-Myofibroblast Crosstalk in Pulmonary Fibrosis: Reconstructing the Vascular Niche; Authors - Yue-Fei Fang

Reviews

4.6 out of 5

10 verified customer reviews

What customers say

Across 10 reviews, this collagen antibody earns an average rating of 4.6/5. Most users report excellent to very good performance in Western blot and immunofluorescence, with strong signal in fibroblasts, HEK cells, colon tissue, and MC3T3-E1 pre-osteoblasts. Dilutions of 1:1000–1:2000 were commonly used. One reviewer noted two bands around 70 kDa in mouse heart tissue, while another recommended stringent wash conditions to reduce ladder staining in Western blot. Overall, users find it reliable and highly specific for collagen I detection.

Automatically generated from the 10 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

John (Verified Customer) (01-30-2026)

Good collagen antibody for IF. Strong signal. Worked well with calcium phosphate cement cultured cells (MC3T3-E1).

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:400
• Cell Tissue Type: MC3T3-E1 pre-osteoblast

Collagen Type I Antibody Immunofluorescence validation (1:400 dilution) in MC3T3-E1 pre-osteoblast (Cat no:14695-1-AP)

p (Verified Customer) (09-23-2024)

Excellent

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: HEK

Collagen Type I Antibody Western Blot validation (1000 dilution) in HEK (Cat no:14695-1-AP)

Brice-Emmanuel (Verified Customer) (10-12-2023)

I have 2 bands in 70 kDa

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Mouse Heart Tissue

Collagen Type I Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:14695-1-AP)

S (Verified Customer) (03-20-2023)

Excellent Antibody!

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: fibroblast

Collagen Type I Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:14695-1-AP)

Balawant Kumar (Verified Customer) (12-20-2022)

antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: colon tissue and colon cancer cell line (caco2, HCT116)

PK (Verified Customer) (07-08-2022)

Very Good

• Applications: Western Blot
• Cell Tissue Type: Fibroblast

Collagen Type I Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:14695-1-AP)

Ren Jie (Verified Customer) (06-22-2022)

Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot

• Applications: Western Blot, Other
• Primary Antibody Dilution: 1:1000

S (Verified Customer) (12-01-2021)

Excellent

• Applications: Western Blot
• Cell Tissue Type: LUNG FIBROBLASTS

Collagen Type I Antibody Western Blot validation ( dilution) in LUNG FIBROBLASTS (Cat no:14695-1-AP)

Hala (Verified Customer) (02-23-2021)

very good

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000

Eistine (Verified Customer) (05-31-2019)

The antibody works pretty good

• Applications: Immunofluorescence,