Collagen Type I Polyclonal antibody

• 

  WB analysis of pig skin using 14695-1-AP

  pig skin tissue were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14695-1-AP

  human placenta tissue was subjected to SDS PAGE followed by western blot with 14695-1-AP (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of U-87 MG using 14695-1-AP

  IP result of anti-Collagen Type I (IP:14695-1-AP, 4ug; Detection:14695-1-AP 1:2000) with U-87 MG cells lysate 1920 ug.

• 

  IHC staining of human skin cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 14695-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 14695-1-AP (Collagen Type I antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of SW480 using 14695-1-AP

  1X10^6 SW480 cells were intracellularly stained with 0.2 ug Anti-Human Collagen Type I (14695-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

The Collagen Type I polyclonal antibody (14695-1-AP) is one of the most highly cited Collagen Type I antibodies in the market. It is suitable for WB, IHC, FC (Intra), IP, ELISA and has been referenced in over 1,219 publications.

Cat No. 14695-1-AP

Publications(1219)

Reviews (9)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (8)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

Synonyms

COL1, COL1A2, Alpha-2 type I collagen, col I, Collagen alpha 2(I) chain

---

Tested Applications

• Positive WB detected in: pig skin tissue, human placenta tissue, MG-63 cells, Saos-2 cells, U-87 MG cells
• Positive IP detected in: U-87 MG cells
• Positive IHC detected in: human skin cancer tissue, human colon tissue, human oesophagus cancer tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: SW480 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 964 publications below
• IHC: See 260 publications below
• IF: See 226 publications below
• IP: See 1 publications below
• FC: See 2 publications below
• CoIP: See 1 publications below

Product Information

14695-1-AP targets Collagen Type I in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, bovine, toad, duck
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6281

  Product name: Recombinant human COL1A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1017-1366 aa of BC054498

  Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

• Full Name: collagen, type I, alpha 2
• Calculated Molecular Weight: 1366 aa, 130 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC054498
• Gene Symbol: COL1A2
• Gene ID (NCBI): 1278
• RRID: AB_2082037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08123
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cancer Cell; Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis; Authors - Jiang Chang
rabbit	IF	Adv Mater; A Superparamagnetic Composite Hydrogel Scaffold as in Vivo Dynamic Monitorable Theranostic Platform for Osteoarthritis Regeneration; Authors - Mayifei Rong
mouse	WB	Gastroenterology; Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells; Authors - Decai Wang
rat	IF	Adv Mater; Acid-Induced in Situ Phase Separation and Percolation for Constructing Bi-Continuous Phase Hydrogel Electrodes With Motion-Insensitive Property; Authors - Qingquan Han
mouse	WB	Gut; Histone methyltransferase Suv39h1 regulates hepatic stellate cell activation and is targetable in liver fibrosis; Authors - Ming Kong
rat	IHC	Bioact Mater; Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair; Authors - Changjian Lin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

p (Verified Customer) (09-23-2024)

Excellent

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: HEK

Collagen Type I Antibody Western Blot validation (1000 dilution) in HEK (Cat no:14695-1-AP)

FH

Brice-Emmanuel (Verified Customer) (10-12-2023)

I have 2 bands in 70 kDa

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Mouse Heart Tissue

Collagen Type I Antibody Western Blot validation (1/1000 dilution) in Mouse Heart Tissue (Cat no:14695-1-AP)

FH

S (Verified Customer) (03-20-2023)

Excellent Antibody!

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: fibroblast

Collagen Type I Antibody Western Blot validation (1000 dilution) in fibroblast (Cat no:14695-1-AP)

FH

Balawant Kumar (Verified Customer) (12-20-2022)

antibody is working great. I have used this antibody for mice colon tissue and colon cancer cell line

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: colon tissue and colon cancer cell line (caco2, HCT116)

FH

PK (Verified Customer) (07-08-2022)

Very Good

• Applications: Western Blot
• Cell Tissue Type: Fibroblast

Collagen Type I Antibody Western Blot validation ( dilution) in Fibroblast (Cat no:14695-1-AP)

FH

Ren Jie (Verified Customer) (06-22-2022)

Very strong signal for collagen I, needs stringent wash conditions to minimize ladder staining in western blot

• Applications: Western Blot, Other
• Primary Antibody Dilution: 1:1000

FH

S (Verified Customer) (12-01-2021)

Excellent

• Applications: Western Blot
• Cell Tissue Type: LUNG FIBROBLASTS

Collagen Type I Antibody Western Blot validation ( dilution) in LUNG FIBROBLASTS (Cat no:14695-1-AP)

FH

Hala (Verified Customer) (02-23-2021)

very good

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000

FH

Eistine (Verified Customer) (05-31-2019)

The antibody works pretty good

• Applications: Immunofluorescence,