COL4A1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 85256-4-RR (same clone as 85256-4-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 85256-4-RR (COL4A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85256-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 85256-4-RR (same clone as 85256-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 85256-4-RR (COL4A1 antibody) at dilution of 1:1500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85256-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 85256-4-RR (same clone as 85256-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 85256-4-RR (COL4A1 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85256-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 85256-4-RR (same clone as 85256-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85256-4-RR (COL4A1 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85256-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 85256-4-RR (same clone as 85256-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85256-4-RR (COL4A1 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85256-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85256-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85256-4-RR against Human COL4A1 were performed. The affinity constant is 1.16 nM.

COL4A1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85256-4-PBS

Clone No.251500E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

arresten, Collagen alpha 1(IV) chain, Collagen alpha-1(IV) chain, Collagen Type IV

---

Product Information

85256-4-PBS targets COL4A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34391

  Product name: Recombinant human COL4A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 901-1110 aa of BC151220

  Sequence: LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGS

• Full Name: collagen, type IV, alpha 1
• Calculated Molecular Weight: 1669 aa, 161 kDa
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: BC151220
• Gene Symbol: COL4A1
• Gene ID (NCBI): 1282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02462
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COL4A1 (Collagen Type IV Alpha 1 Chain) encodes a major component of type IV collagen, which is an essential structural element of basement membranes in various tissues. COL4A1 forms heterotrimers with other collagen type IV chains (e.g., COL4A2) and interacts with extracellular matrix components such as laminins, proteoglycans, and perlecans. Proteolytic cleavage of the non-collagenous domain of COL4A1 produces a fragment called arresten, which has anti-angiogenic and tumor suppressor properties. Elevated expression of COL4A1 has been observed in various cancers, including hepatocellular carcinoma (HCC), where it promotes tumor growth and metastasis through the FAK-Src signaling pathway. COL4A1 is highly expressed in various tissues, including the placenta, fat, and other organs. The expression of COL4A1 can be regulated by transcription factors such as RUNX1, which has been shown to upregulate COL4A1 in hepatocellular carcinoma.