COL8A1 Recombinant monoclonal antibody

• 

  WB analysis using 87280-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87280-1-RR (COL8A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87280-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87280-1-RR against Human COL8A1 were performed. The affinity constant is 0.786 nM.

COL8A1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87280-1-RR

Clone No.252552D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

COL8, C3orf7, Collagen alpha-1(VIII) chain, Collagen Type VIII

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, U-251 cells, 5637 cells, A172 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87280-1-RR targets COL8A1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10607

  Product name: Recombinant human COL8A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 396-744 aa of BC013581

  Sequence: GIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

• Full Name: collagen, type VIII, alpha 1
• Calculated Molecular Weight: 744 aa, 73 kDa
• Observed Molecular Weight: 73-75 kDa
• GenBank Accession Number: BC013581
• Gene Symbol: COL8A1
• Gene ID (NCBI): 1295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27658
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.