CPLX2 Monoclonal antibody, PBS Only (Capture)

CPLX2 Monoclonal Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 66849-1-PBS
Clone No.1B2A11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

1B2A11, 921 L, 921L, Complexin-2, CPLX 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66849-1-PBS targets CPLX2 as part of a matched antibody pair:

MP51525-1: 66849-1-PBS capture and 66849-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27949

Product name: Recombinant human CPLX2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-134 aa of BC093706

Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

Predict reactive species
Full Name complexin 2
Calculated Molecular Weight 134 aa, 15 kDa
Observed Molecular Weight 18-20 kDa
GenBank Accession NumberBC093706
Gene Symbol CPLX2
Gene ID (NCBI) 10814
RRIDAB_2882189
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6PUV4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Complexins are soluble proteins that regulate the activity of soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complexes necessary for vesicle fusion. Neuronal specific complexin 1 (CPLX1) has inhibitory and stimulatory effects on exocytosis by clamping trans-SNARE complexes in a prefusion state and promoting conformational changes to facilitate membrane fusion following cell stimulation. Complexin2 (CPLX2) is a pre-synaptic protein believed to regulate neurotransmitter release from pre-synaptic terminals, it is downregulated in schizophrenic patients suffering from depression, animal models of depression and neurological disorders such as Huntington's disease in which depression is a major symptom.

Loading...
||
New chat Able
正在加载,请稍候...