CPLX2 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 66849-1-Ig (same clone as 66849-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66849-1-Ig (CPLX2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 66849-1-Ig (same clone as 66849-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 66849-1-Ig (CPLX2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 66849-1-Ig (same clone as 66849-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66849-1-Ig (CPLX2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat cerebellum using 66849-1-Ig (same clone as 66849-1-PBS)

  rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 66849-1-Ig (CPLX2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66849-1-Ig (same clone as 66849-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66849-1-Ig (CPLX2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66849-1-Ig (same clone as 66849-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66849-1-Ig (CPLX2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 66849-1-Ig (same clone as 66849-1-PBS)

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug CPLX2 Monoclonal antibody (66849-1-Ig, Clone:1B2A11) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66849-1-PBS in a different storage buffer formulation.

CPLX2 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 66849-1-PBS

Clone No.1B2A11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

CPX 2, CPLX 2, Complexin-2, 921L, 921 L

---

Product Information

66849-1-PBS targets CPLX2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27949

  Product name: Recombinant human CPLX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-134 aa of BC093706

  Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

• Full Name: complexin 2
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC093706
• Gene Symbol: CPLX2
• Gene ID (NCBI): 10814
• RRID: AB_2882189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6PUV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complexins are soluble proteins that regulate the activity of soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complexes necessary for vesicle fusion. Neuronal specific complexin 1 (CPLX1) has inhibitory and stimulatory effects on exocytosis by clamping trans-SNARE complexes in a prefusion state and promoting conformational changes to facilitate membrane fusion following cell stimulation. Complexin2 (CPLX2) is a pre-synaptic protein believed to regulate neurotransmitter release from pre-synaptic terminals, it is downregulated in schizophrenic patients suffering from depression, animal models of depression and neurological disorders such as Huntington's disease in which depression is a major symptom.