CRABP1 Polyclonal antibody

• 

  WB analysis of mouse embryo using 12588-1-AP

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 12588-1-AP (CRABP1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 12588-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 12588-1-AP (CRABP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 12588-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 12588-1-AP (CRABP1 Antibody) at dilution of 1:700 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 12588-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12588-1-AP (CRABP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 12588-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12588-1-AP (CRABP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CRABP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12588-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

CRABP, CRABP I, CRABP1, CRABPI, RBP5

---

Tested Applications

• Positive WB detected in: mouse embryo tissue, human spleen tissue, Transfected HEK-293 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

12588-1-AP targets CRABP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rabbit, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3291

  Product name: Recombinant human CRABP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of BC022069

  Sequence: MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE

• Full Name: cellular retinoic acid binding protein 1
• Calculated Molecular Weight: 137 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC022069
• Gene Symbol: CRABP1
• Gene ID (NCBI): 1381
• RRID: AB_2292271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29762
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The cellular retinoic acid-binding proteins including CRABP1 and CRABP2 bind retinoic acid (RA), an important regulator of cell growth and differentiation, thus play an important role in RA-mediated differentiation and proliferation processes. It has been reported that CRABP1 influences the biological effects of RA in cell-selective manners by enhancing the physiological function of RA in keratinocytes or inhibiting RA-induced differentiation of neuroblastoma cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
chicken	IF	Elife; Single-cell proteomics reveals changes in expression during hair-cell development.; Authors - Ying Zhu
human	WB,IHC	Mol Oncol; CRABP-II methylation: a critical determinant of retinoic acid resistance of medulloblastoma cells.; Authors - Fu Yuan-Shan YS
human	WB	Cell Rep; Greater epithelial ridge cells are the principal organoid-forming progenitors of the mouse cochlea.; Authors - Marie Kubota
mouse	WB	Virol J; All-trans retinoic acid increases the pathogenicity of the H9N2 influenza virus in mice; Authors - Xiaofei Niu
		Cell Rep; Dynamic interplay between IL-1 and WNT pathways in regulating dermal adipocyte lineage cells during skin development and wound regeneration; Authors - Lixiang Sun
rabbit	WB	Biol Reprod; 4D label-free quantitative proteomic analysis identifies CRABP1 as a novel candidate gene for litter size in rabbits; Authors - Zhiyuan Bao