CRMP1 Polyclonal antibody, PBS Only

• 

  WB analysis using 29497-1-AP (same clone as 29497-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 29497-1-AP (CRMP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29497-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29497-1-AP (same clone as 29497-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29497-1-AP (CRMP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29497-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29497-1-AP (same clone as 29497-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29497-1-AP (CRMP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29497-1-PBS in a different storage buffer formulation.

CRMP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29497-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29497-1-PBS targets CRMP1 in WB, IHC, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31559

  Product name: Recombinant human CRMP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-537 aa of NM_001014809

  Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS

• Full Name: collapsin response mediator protein 1
• Calculated Molecular Weight: 62KD
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: NM_001014809
• Gene Symbol: CRMP1
• Gene ID (NCBI): 1400
• RRID: AB_2918317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14194
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62-kDa protein and its 75-kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.