CRTAM/CD355 Recombinant monoclonal antibody, PBS Only

• 

CRTAM/CD355 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84068-2-PBS

Clone No.241280C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

CRTAM, CD355, Class-I MHC-restricted T-cell-associated molecule, Cytotoxic and regulatory T-cell molecule

---

Product Information

84068-2-PBS targets CRTAM/CD355 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1541

  Product name: Recombinant Human CRTAM protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 18-286 aa of NM_019604.4

  Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

• Full Name: cytotoxic and regulatory T cell molecule
• Calculated Molecular Weight: 45 kDa
• GenBank Accession Number: NM_019604.4
• Gene Symbol: CRTAM
• Gene ID (NCBI): 56253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95727-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.