Citrate synthase Polyclonal antibody

• 

  WB analysis using 16131-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16131-1-AP (Citrate synthase antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 16131-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16131-1-AP (Citrate synthase antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16131-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16131-1-AP (Citrate synthase antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16131-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16131-1-AP (Citrate synthase antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 16131-1-AP

  IP result of anti-Citrate synthase (IP:16131-1-AP, 4ug; Detection:16131-1-AP 1:1000) with mouse heart tissue lysate 3200ug.

• 

  IHC staining of human liver cancer using 16131-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16131-1-AP (Citrate synthase antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16131-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16131-1-AP (Citrate synthase antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16131-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Citrate synthase antibody (16131-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 16131-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 16131-1-AP (Citrate synthase antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Citrate synthase Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16131-1-AP

Publications(89)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

CS, CISY, Citrate, Citrate synthase, mitochondrial, EC:2.3.3.1

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, HepG2 cells, MDA-MB-231 cells
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 73 publications below
• IHC: See 4 publications below
• IF: See 10 publications below
• IP: See 3 publications below
• CoIP: See 1 publications below

Product Information

16131-1-AP targets Citrate synthase in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, rabbit, chicken, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9117

  Product name: Recombinant human CS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-466 aa of BC010106

  Sequence: EQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

• Full Name: citrate synthase
• Calculated Molecular Weight: 466 aa, 52 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC010106
• Gene Symbol: Citrate Synthase
• Gene ID (NCBI): 1431
• RRID: AB_1640013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75390
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Citrate synthase (CS), the first and rate-limiting enzyme of the tricarboxylic acid cycle, plays a key role in regulating energy generation of mitochondrial respiration(PMID:19479947).It belongs to the citrate synthase family. The deduced 466-amino acid protein contains an N-terminal mitochondrial targeting sequence and a motif highly conserved in citrate synthases(PMID:12549038). It can exsit as a dimer(PMID:8749851). Northern blot analysis detected no CS expression in thymus and small intestine(PMID:12549038). This antibody is specific to CS.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Mater; Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration; Authors - Zhuo Li
human	WB	Nat Cell Biol; Breast-cancer-secreted miR-122 reprograms glucose metabolism in premetastatic niche to promote metastasis.; Authors - Miranda Y Fong
mouse	IF	Nat Neurosci; A glycolytic shift in Schwann cells supports injured axons.; Authors - Elisabetta Babetto
human	IF	ACS Cent Sci; A Selective SARS-CoV-2 Host-Directed Antiviral Targeting Stress Response to Reactive Oxygen Species; Authors - Cong Tang
human	IF	Mol Cell; Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.; Authors - Bin Jiang
human	WB	Nat Commun; Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1.; Authors - Xiaoyu Ma

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sami Elamin Mustafa (Verified Customer) (01-31-2025)

The antibody works nicely giving clear sharp bands as expected.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human

FH

RAHUL (Verified Customer) (07-03-2019)

Works very good with human cell lysates. 1:1000 dilution in 5% milk; 1 hr incubation at RT.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: DU145 prostate cancer cells