Tested Applications
| Positive IP detected in | THP-1 cells |
| Positive IHC detected in | human cerebellum tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25949-1-AP targets CSF1R/CD115 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22845 Product name: Recombinant human CSF1R protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-369 aa of BC047521 Sequence: IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIHQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANVTTKDTYRHTFTLSLP Predict reactive species |
| Full Name | colony stimulating factor 1 receptor |
| Calculated Molecular Weight | 972 aa, 108 kDa |
| GenBank Accession Number | BC047521 |
| Gene Symbol | CSF1R/CD115 |
| Gene ID (NCBI) | 1436 |
| RRID | AB_2880306 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07333 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CSF1R (colony-stimulating factor 1 receptor) belongs to the type III protein tyrosine kinase receptor family. CSF1R-mediated signaling is crucial for the differentiation and survival of the mononuclear phagocyte system and macrophages in particular (PMID: 28716061).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CSF1R/CD115 antibody 25949-1-AP | Download protocol |
| IHC protocol for CSF1R/CD115 antibody 25949-1-AP | Download protocol |
| IP protocol for CSF1R/CD115 antibody 25949-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CSF1R/CD115 Polyclonal antibody (Cat# 25949-1-AP) has 18 citations spanning journals including Adv Sci, Cell Rep Med, J Immunother Cancer, FASEB J, J Transl Med, Front Immunol, CNS Neurosci Ther, Arthritis Res Ther, Toxics, Cancers, Cancer Res Commun, J Immunol, Int J Exp Pathol, Front Genet, J Nat Med, Am J Mens Health, and Heliyon. Research fields cover lung adenocarcinoma, glioma, endometrial cancer, cardiac remodelling, NAFLD, chondropathies, macrophage biology, pancreatic cancer, pre-eclampsia, cerebral ischemia, and testicular dysfunction.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Excessive MYC Orchestrates Macrophages induced Chromatin Remodeling to Sustain Micropapillary-Patterned Malignancy in Lung Adenocarcinoma | ||
Cell Rep Med Tumor heterogeneity and tumor-microglia interactions in primary and recurrent IDH1-mutant gliomas | ||
J Immunother Cancer Antagonism of estrogen-related receptor-α inhibits mitochondrial oxidative phosphorylation and reduces M2 macrophage infiltration in endometrial cancer | ||
J Transl Med ITIH5-mediated fibroblast/macrophage crosstalk exacerbates cardiac remodelling after myocardial infarction | ||
Front Immunol Identification of key genes in membranous nephropathy and non-alcoholic fatty liver disease by bioinformatics and machine learning. | ||
CNS Neurosci Ther A novel chemokine-based signature for prediction of prognosis and therapeutic response in glioma |
Reviews
What customers say
The single review reports using this antibody for immunohistochemistry on PFA-fixed synovium slides to detect macrophages. The user rated it 5 stars and noted that it works well for this application. Overall, the feedback is positive, with the reviewer confirming reliable performance in IHC on fixed tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jaouhara (Verified Customer) (12-05-2023) | Used in synovium PFA-fixed slides to detect macrophages. Works well.
|
