CSF1R/CD115 Polyclonal antibody

CSF1R/CD115 Polyclonal Antibody for IHC, IF/ICC, IF-P, ELISA
Cat No. 25949-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

CSF1R, C FMS, CD115, CSF 1 R, CSF-1 receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue, human brain tissue, human cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25949-1-AP targets CSF1R/CD115 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22845

Product name: Recombinant human CSF1R protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-369 aa of BC047521

Sequence: IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIHQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANVTTKDTYRHTFTLSLP

Predict reactive species
Full Name colony stimulating factor 1 receptor
Calculated Molecular Weight 972 aa, 108 kDa
GenBank Accession NumberBC047521
Gene Symbol CSF1R/CD115
Gene ID (NCBI) 1436
RRIDAB_2880306
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07333
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSF1R (colony-stimulating factor 1 receptor) belongs to the type III protein tyrosine kinase receptor family. CSF1R-mediated signaling is crucial for the differentiation and survival of the mononuclear phagocyte system and macrophages in particular (PMID: 28716061).

Protocols

Product Specific Protocols
IF protocol for CSF1R/CD115 antibody 25949-1-APDownload protocol
IHC protocol for CSF1R/CD115 antibody 25949-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancers (Basel)

Targeting CSF1R Alone or in Combination with PD1 in Experimental Glioma.

Authors - Justyna M Przystal
humanIHC

Arthritis Res Ther

Integrating transcriptome-wide study and mRNA expression profiles yields novel insights into the biological mechanism of chondropathies.

Authors - Ping Li
humanIHC

CNS Neurosci Ther

A novel chemokine-based signature for prediction of prognosis and therapeutic response in glioma

Authors - Wenhua Fan
ratWB

J Nat Med

Insight of action mechanism of Astragaloside IV for relieving of cerebral ischemic injury in a rat model of middle cerebral artery occlusion reperfusion via proteomics and network pharmacology

Authors - Xin-Hua Zhu
mouseWB

J Transl Med

ITIH5-mediated fibroblast/macrophage crosstalk exacerbates cardiac remodelling after myocardial infarction

Authors - Yirong Wu
mouseWB

Toxics

CuO-NPs Induce Apoptosis and Functional Impairment in BV2 Cells Through the CSF-1R/PLCγ2/ERK/Nrf2 Pathway

Authors - Linhui Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jaouhara (Verified Customer) (12-05-2023)

Used in synovium PFA-fixed slides to detect macrophages. Works well.

  • Applications: Immunohistochemistry
Loading...
||
New chat Able
正在加载,请稍候...